Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN3 Rabbit Polyclonal Antibody (HRP)

UBQLN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TUP-1

UniProt

Q9H347

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBQLN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (AP)
MBS6132007-01 0.1 mL

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (AP)

Sign In for Pricing
View Details
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (AP)
MBS6132007-02 5x 0.1 mL

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (AP)

Sign In for Pricing
View Details
MOR-1 Rabbit Polyclonal Antibody
APRab14030-01 20 µL

MOR-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOR-1 Rabbit Polyclonal Antibody
APRab14030-02 50 µL

MOR-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOR-1 Rabbit Polyclonal Antibody
APRab14030-03 100 µL

MOR-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOR-1 Rabbit Polyclonal Antibody
APRab14030-04 200 µL

MOR-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details