Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN3 Rabbit Polyclonal Antibody (HRP)

UBQLN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TUP-1

UniProt

Q9H347

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBQLN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX1 (NM_080647) Human Over-expression Lysate
LY409117 100 µg

TBX1 (NM_080647) Human Over-expression Lysate

Sign In for Pricing
View Details
YWHAZ Antibody
A11224-50UG 50 µg

YWHAZ Antibody

Sign In for Pricing
View Details
XRCC6, CT (XRCC6, G22P1, X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 70kD subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, DNA repair protein XRCC6, Lupus Ku autoantigen protein p70, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 6) (MaxLight 490) discontinued
043935-ML490 100 µL

XRCC6, CT (XRCC6, G22P1, X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 70kD subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, DNA repair protein XRCC6, Lupus Ku autoantigen protein p70, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 6) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Saccharum hybrid NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG), partial
MBS7087352 Inquire

Recombinant Saccharum hybrid NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG), partial

Sign In for Pricing
View Details
SLAMF5 Antibody / CD84
V2945-100UG 100 µg

SLAMF5 Antibody / CD84

Sign In for Pricing
View Details
Human IgG (H+L chain) Chicken Polyclonal Antibody
AP31797PU-N 1 mL

Human IgG (H+L chain) Chicken Polyclonal Antibody

Sign In for Pricing
View Details