Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHC1 Rabbit Polyclonal Antibody (Biotin)

EFHC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EJM1, POC9, RIB72, dJ304B14.2

UniProt

Q5JVL4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EFHC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (HRP)
MBS6420373-01 0.1 mL

HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (HRP)

Sign In for Pricing
View Details
HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (HRP)
MBS6420373-02 5x 0.1 mL

HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (HRP)

Sign In for Pricing
View Details
ST3GAL5 polyclonal antibody
BS71010-01 50 µL

ST3GAL5 polyclonal antibody

Sign In for Pricing
View Details
ST3GAL5 polyclonal antibody
BS71010-02 100 µL

ST3GAL5 polyclonal antibody

Sign In for Pricing
View Details
Troponin C, Skeletal (sTnC, TNNC1, Troponin C, slow skeletal and cardiac muscles, TNNC) (PE) discontinued
T8665-10B-PE 100 µL

Troponin C, Skeletal (sTnC, TNNC1, Troponin C, slow skeletal and cardiac muscles, TNNC) (PE) discontinued

Sign In for Pricing
View Details
SCN1A Protein Vector (Rat) (pPB-N-His)
PV303559 500 ng

SCN1A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details