Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHC1 Rabbit Polyclonal Antibody (HRP)

EFHC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EJM1, POC9, RIB72, dJ304B14.2

UniProt

Q5JVL4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EFHC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Menin/MEN1 Picoband® Antibody-FITC Conjugate
A00331-1-FITC 100 µg/Vial

Anti-Menin/MEN1 Picoband® Antibody-FITC Conjugate

Sign In for Pricing
View Details
Glibenclamide Impurity 10
RM-G120510-01 10 mg

Glibenclamide Impurity 10

Sign In for Pricing
View Details
Glibenclamide Impurity 10
RM-G120510-02 25 mg

Glibenclamide Impurity 10

Sign In for Pricing
View Details
Glibenclamide Impurity 10
RM-G120510-03 50 mg

Glibenclamide Impurity 10

Sign In for Pricing
View Details
Glibenclamide Impurity 10
RM-G120510-04 100 mg

Glibenclamide Impurity 10

Sign In for Pricing
View Details
LAPTM4A (KIAA0108, LAPTM4, MBNT, MTRP, Lysosomal-associated Transmembrane Protein 4A, Golgi 4-transmembrane-spanning Transporter MTP, UNQ1846/PRO3574, HUMORF13) (FITC)
138078-FITC 100 µL

LAPTM4A (KIAA0108, LAPTM4, MBNT, MTRP, Lysosomal-associated Transmembrane Protein 4A, Golgi 4-transmembrane-spanning Transporter MTP, UNQ1846/PRO3574, HUMORF13) (FITC)

Sign In for Pricing
View Details