Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA9 Rabbit Polyclonal Antibody (HRP)

SPACA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ma, MAST, 1700026L06Rik

UniProt

Q7TPM5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6773-3p miRNA Inhibitor
CIH2210-01 10 nmol

Hsa-miR-6773-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6773-3p miRNA Inhibitor
CIH2210-02 20 nmol

Hsa-miR-6773-3p miRNA Inhibitor

Sign In for Pricing
View Details
AraB Antibody
orb809745 2 mg

AraB Antibody

Sign In for Pricing
View Details
Mouse Dnajc1 qPCR Primer Pair
QM12198S 200 Tests

Mouse Dnajc1 qPCR Primer Pair

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2163915-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)
MBS2163915-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Octamer Binding Transcription Factor 4 (OCT4)

Sign In for Pricing
View Details