Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM190B Rabbit Polyclonal Antibody (HRP)

FAM190B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gcap14, FAM190B, KIAA1128, bA486O22.1

UniProt

Q9H7U1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDCTAVKTQLLKLKRLLHQHDGSGSLHDIQLSLPSSPEPEDGDKVYKNED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fasinumab (NGF/NGFB) - Research Grade Biosimilar
10-490 0.1 mg

Fasinumab (NGF/NGFB) - Research Grade Biosimilar

Sign In for Pricing
View Details
Anti-ERGIC2 Antibody Picoband®
A10196-1-carrier-free 100 µg/Vial

Anti-ERGIC2 Antibody Picoband®

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0053270-01 20 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0053270-02 100 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0053270-03 200 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0053270-04 1 mL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details