Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSCN3 Rabbit Polyclonal Antibody (HRP)

FSCN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9NQT6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FSCN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Acetylcholinesterase Antibody ELISA Kit
MBS043403-01 48 Well

Rat Acetylcholinesterase Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Acetylcholinesterase Antibody ELISA Kit
MBS043403-02 96 Well

Rat Acetylcholinesterase Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Acetylcholinesterase Antibody ELISA Kit
MBS043403-03 5x 96 Well

Rat Acetylcholinesterase Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Acetylcholinesterase Antibody ELISA Kit
MBS043403-04 10x 96 Well

Rat Acetylcholinesterase Antibody ELISA Kit

Sign In for Pricing
View Details
Atrial Natriuretic Factor (5-27) (human)
4095498.0500 0.5 mg

Atrial Natriuretic Factor (5-27) (human)

Sign In for Pricing
View Details
Rabbit Monoclonal TREM2 Antibody (HL1738) - Azide and BSA Free
NBP3-25728 100 µL

Rabbit Monoclonal TREM2 Antibody (HL1738) - Azide and BSA Free

Sign In for Pricing
View Details