Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSCN3 Rabbit Polyclonal Antibody (HRP)

FSCN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9NQT6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FSCN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100360314 3'UTR GFP Stable Cell Line
TU257519 1.0 mL

LOC100360314 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Nlrp9a CRISPRa sgRNA lentivector (set of three targets)(Mouse)
31930124 3x 1.0µg DNA

Nlrp9a CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Ano4 Pre-designed siRNA Set A
SI100697A 1 Each

Mouse Ano4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Hspa13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3150705 3x 1.0 µg

Hspa13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SSRP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45551061 1.0 µg DNA

SSRP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human CD160 Antigen (CD160) Protein
abx620215-01 100 µg

Human CD160 Antigen (CD160) Protein

Sign In for Pricing
View Details