Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGBL5 Rabbit Polyclonal Antibody (FITC)

AGBL5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCP5, RP75

UniProt

Q8NDL9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AGBL5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

EAX00650

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYO-GLOVES® Shoulder, XXL, Blue
1464397 1 Unit

CRYO-GLOVES® Shoulder, XXL, Blue

Sign In for Pricing
View Details
Recombinant Human PIM1 Protein, N-His
HY563012-01 50 µg

Recombinant Human PIM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PIM1 Protein, N-His
HY563012-02 100 µg

Recombinant Human PIM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PIM1 Protein, N-His
HY563012-03 1 mg

Recombinant Human PIM1 Protein, N-His

Sign In for Pricing
View Details
Pancreas Membrane Diabetic Disease Lysate
orb1672403 0.1 mg

Pancreas Membrane Diabetic Disease Lysate

Sign In for Pricing
View Details
DHRS7, NT (DHRS7, DHRS7A, RETSDR4, Dehydrogenase/reductase SDR family member 7, Retinal short-chain dehydrogenase/reductase 4) (MaxLight 650) discontinued
034625-ML650 100 µL

DHRS7, NT (DHRS7, DHRS7A, RETSDR4, Dehydrogenase/reductase SDR family member 7, Retinal short-chain dehydrogenase/reductase 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details