Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLF1 Rabbit Polyclonal Antibody (FITC)

MLF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P58340

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella dysenteriae serotype 1 DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1317593 Inquire

Recombinant Shigella dysenteriae serotype 1 DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
Cyp2j10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV631383 1.0 µg DNA

Cyp2j10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-3675-3p Vector
mh30640 500 ng

LentimiRa-Off-hsa-miR-3675-3p Vector

Sign In for Pricing
View Details
Biotinylated Human B7-H4 (C-Fc-Avi)
CY37-20ug 20 µg

Biotinylated Human B7-H4 (C-Fc-Avi)

Sign In for Pricing
View Details
MEK1, MEK2, phosphorylated (Ser218/222, Ser222/226) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (MaxLight 550) discontinued
M2865-10B-ML550 100 µL

MEK1, MEK2, phosphorylated (Ser218/222, Ser222/226) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Monkey Xaa-Pro aminopeptidase 2  ELISA Kit
MBS7277915-01 48 Well

Monkey Xaa-Pro aminopeptidase 2  ELISA Kit

Sign In for Pricing
View Details