Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf39 Rabbit Polyclonal Antibody (HRP)

C17orf39 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VID2, VID24, C17orf39

UniProt

Q8IVV7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-N,N-diethylethylamine-d10 Hydrochloride
TRC-C421853-10MG 10 mg

2-Chloro-N,N-diethylethylamine-d10 Hydrochloride

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-SBA Antibody
BAL-1301-2 2 mL

Biotin Conjugated Rabbit Anti-SBA Antibody

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF640R conjugate, 0.1mg/mL
BNC402422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-UNEL-M0125-01 5x 96 Tests

Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-UNEL-M0125-02 15x 96 Tests

Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), Biotin conjugate, 0.1mg/mL
BNCB1706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details