Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNDC11 Rabbit Polyclonal Antibody (Biotin)

FNDC11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C20orf195

UniProt

Q9BVV2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C20orf195

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FDRKASAAHQDWARLRWFVTIQPATSEQYELRFRLLDPRTQQECAQCGVI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_076964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC677654 3'UTR GFP Stable Cell Line
TU162514 1.0 mL

LOC677654 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Fratercula cirrhata NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)
MBS1058299 Inquire

Recombinant Fratercula cirrhata NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Sign In for Pricing
View Details
Lentiviral human ITGAE shRNA (UAS) - Lentiviral human ITGAE shRNA (UAS) (100)
GTR15286938 1 Vial

Lentiviral human ITGAE shRNA (UAS) - Lentiviral human ITGAE shRNA (UAS) (100)

Sign In for Pricing
View Details
MS4A1, CD20, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen=CD20) (MaxLight 405) discontinued
031138-ML405 100 µL

MS4A1, CD20, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen=CD20) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-RNF111 Antibody Picoband®, HRP Conjugate
A05708-1-HRP 100 µg/Vial

Anti-RNF111 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Canine 26S proteasome non-ATPase regulatory subunit 12 (PSMD12) ELISA Kit
GTR10326515 96 Well

Canine 26S proteasome non-ATPase regulatory subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details