Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP130 Rabbit Polyclonal Antibody (FITC)

SAP130 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H0E3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAP130

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF594 conjugate, 0.1mg/mL
BNC940502-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CXCR2 Human Recombinant Protein, Synthetic Nanodisc
TP721436 10 µg

CXCR2 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
SH3D19 (NM_001009555) Human Over-expression Lysate
LY432388 100 µg

SH3D19 (NM_001009555) Human Over-expression Lysate

Sign In for Pricing
View Details
Elongin A (TCEB3) (NM_003198) Human Over-expression Lysate
LY418839 100 µg

Elongin A (TCEB3) (NM_003198) Human Over-expression Lysate

Sign In for Pricing
View Details
CellBrite® Steady 594 Membrane Staining Kit, 500 Labelings
#30142 1 Kit

CellBrite® Steady 594 Membrane Staining Kit, 500 Labelings

Sign In for Pricing
View Details
FBN3 Human Gene Knockout Kit (CRISPR)
KN419167 1 Kit

FBN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details