Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP130 Rabbit Polyclonal Antibody (HRP)

SAP130 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H0E3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAP130

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pex11c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3047007 1.0 µg DNA

Pex11c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Guinea pig 1, 3-Disphosphoglycerate ELISA Kit
MBS723575-01 48 Well

Guinea pig 1, 3-Disphosphoglycerate ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1, 3-Disphosphoglycerate ELISA Kit
MBS723575-02 96 Well

Guinea pig 1, 3-Disphosphoglycerate ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1, 3-Disphosphoglycerate ELISA Kit
MBS723575-03 5x 96 Well

Guinea pig 1, 3-Disphosphoglycerate ELISA Kit

Sign In for Pricing
View Details
Guinea pig 1, 3-Disphosphoglycerate ELISA Kit
MBS723575-04 10x 96 Well

Guinea pig 1, 3-Disphosphoglycerate ELISA Kit

Sign In for Pricing
View Details
Stathmin 2 protein
30R-1422 0.1 mg

Stathmin 2 protein

Sign In for Pricing
View Details