Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP130 Rabbit Polyclonal Antibody (HRP)

SAP130 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H0E3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAP130

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO Monoclonal Osteoactivin/GPNMB Antibody (glembatumumab) - IgG2SA - (Dry Ice)
NBP3-28144-100ug 100 µg

CHO Monoclonal Osteoactivin/GPNMB Antibody (glembatumumab) - IgG2SA - (Dry Ice)

Sign In for Pricing
View Details
Gnb3 (NM_021858) Rat Tagged Lenti ORF Clone
RR204438L3 10 µg

Gnb3 (NM_021858) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GJD2 (Gap Junction Protein, delta 2, 36kD, CX36, GJA9, MGC138315, MGC138319) (Biotin)
MBS6174534-01 0.1 mL

GJD2 (Gap Junction Protein, delta 2, 36kD, CX36, GJA9, MGC138315, MGC138319) (Biotin)

Sign In for Pricing
View Details
GJD2 (Gap Junction Protein, delta 2, 36kD, CX36, GJA9, MGC138315, MGC138319) (Biotin)
MBS6174534-02 5x 0.1 mL

GJD2 (Gap Junction Protein, delta 2, 36kD, CX36, GJA9, MGC138315, MGC138319) (Biotin)

Sign In for Pricing
View Details
Rdh19 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38770154 3x 1.0 µg DNA

Rdh19 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PER3 Antibody
A30968-100UL 100 µL

PER3 Antibody

Sign In for Pricing
View Details