Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC7 Rabbit Polyclonal Antibody (Biotin)

CCDC7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BIOT2, BioT2-A, BioT2-B, BioT2-C, C10orf68

UniProt

Q9H943

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQTYQAAEKSQAHNEVPNERLVVEHQESLSKTKLQIKKQETSTEQPLTTP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_078964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cancer-Related nucleoside-triPhosphatase (C1orf57) Human ELISA Kit
C0988 96 Tests

Cancer-Related nucleoside-triPhosphatase (C1orf57) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Sptlc3 shRNA (UAS) - Lentiviral mouse Sptlc3 shRNA (UAS, iRFP) (100)
GTR15223383 1 Vial

Lentiviral mouse Sptlc3 shRNA (UAS) - Lentiviral mouse Sptlc3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-ACAD9 Antibody Picoband® (Dylight488 Conjugate)
A05223-2-Dylight488 100 µg

Anti-ACAD9 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
TNF-alpha, Recombinant, Rat (Tumor Necrosis Factor, Cachectin, Tnf, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tnfa, Tnfsf2) discontinued
169761-01 10 µg

TNF-alpha, Recombinant, Rat (Tumor Necrosis Factor, Cachectin, Tnf, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tnfa, Tnfsf2) discontinued

Sign In for Pricing
View Details
TNF-alpha, Recombinant, Rat (Tumor Necrosis Factor, Cachectin, Tnf, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tnfa, Tnfsf2) discontinued
169761-02 50 µg

TNF-alpha, Recombinant, Rat (Tumor Necrosis Factor, Cachectin, Tnf, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tnfa, Tnfsf2) discontinued

Sign In for Pricing
View Details
Human Osteoprotegerin/TNFRSF11B ELISA Kit
NR-E10337-01 96 Tests

Human Osteoprotegerin/TNFRSF11B ELISA Kit

Sign In for Pricing
View Details