Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLMN Rabbit Polyclonal Antibody (Biotin)

CLMN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ12383, KIAA1188

UniProt

Q96JQ2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Yeast

Tested Applications

WB

NCBI Accession Number

NP_079010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnaic2 Mouse qPCR Primer Pair (NM_001034878)
MP204007 200 Reactions

Dnaic2 Mouse qPCR Primer Pair (NM_001034878)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rabbit IgA Fc Secondary Antibody [FITC] (Azide Free)
NBP2-69214 1 mL

Goat Polyclonal Goat anti-Rabbit IgA Fc Secondary Antibody [FITC] (Azide Free)

Sign In for Pricing
View Details
ARFIP2 Antibody - middle region (ARP54459_P050)
ARP54459_P050 100 µL

ARFIP2 Antibody - middle region (ARP54459_P050)

Sign In for Pricing
View Details
Cdx4 Rabbit Polyclonal Antibody (FITC)
orb2131294 100 µL

Cdx4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
XAGE1E CRISPR Knock Out 293T Cell Line (Human)
50500141 1x 10^6 Cells / 1.0 mL

XAGE1E CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal GCH1 Antibody
NBP1-84949 0.1 mL

Rabbit Polyclonal GCH1 Antibody

Sign In for Pricing
View Details