Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLMN Rabbit Polyclonal Antibody (HRP)

CLMN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ12383, KIAA1188

UniProt

Q96JQ2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Yeast

Tested Applications

WB

NCBI Accession Number

NP_079010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mageb3 shRNA (UAS) - Lentiviral mouseMageb3 shRNA (UAS, GFP) (25)
GTR15148148 1 Vial

Lentiviral mouse Mageb3 shRNA (UAS) - Lentiviral mouseMageb3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Anti-Human CD11a mAb (PE/TR)
orb2710072 100 Tests

Mouse Anti-Human CD11a mAb (PE/TR)

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-01 48 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-02 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-03 5x 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-04 10x 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details