Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Schip1 Rabbit Polyclonal Antibody (FITC)

Schip1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SCHI, Nf2ip, Schip-1

UniProt

Q3TI53

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MagBead DNA/RNA Wash 2 (concentrate), 20 mL
R2130-2-20 20 mL

MagBead DNA/RNA Wash 2 (concentrate), 20 mL

Sign In for Pricing
View Details
1- (4-Hydroxyphenyl) pyridin-2 (1H) -one
H9110-19Z 5 mg

1- (4-Hydroxyphenyl) pyridin-2 (1H) -one

Sign In for Pricing
View Details
CALML6 (CAGLP, CALGP, Calmodulin-like Protein 6, Calglandulin-like Protein) (MaxLight 650)
MBS6372033-01 0.1 mL

CALML6 (CAGLP, CALGP, Calmodulin-like Protein 6, Calglandulin-like Protein) (MaxLight 650)

Sign In for Pricing
View Details
CALML6 (CAGLP, CALGP, Calmodulin-like Protein 6, Calglandulin-like Protein) (MaxLight 650)
MBS6372033-02 5x 0.1 mL

CALML6 (CAGLP, CALGP, Calmodulin-like Protein 6, Calglandulin-like Protein) (MaxLight 650)

Sign In for Pricing
View Details
SMURF1 (E3 Ubiquitin-protein Ligase SMURF1, hSMURF1, SMAD Ubiquitination Regulatory Factor 1, KIAA1625, SMAD-specific E3 Ubiquitin-protein Ligase 1)
133591 100 µg

SMURF1 (E3 Ubiquitin-protein Ligase SMURF1, hSMURF1, SMAD Ubiquitination Regulatory Factor 1, KIAA1625, SMAD-specific E3 Ubiquitin-protein Ligase 1)

Sign In for Pricing
View Details
MUC1 Rabbit pAb
orb2711390-01 50 µL

MUC1 Rabbit pAb

Sign In for Pricing
View Details