Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Schip1 Rabbit Polyclonal Antibody (HRP)

Schip1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCHI, Nf2ip, Schip-1

UniProt

Q3TI53

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FTSJD1 Protein, His (Fc)-Avi-tagged
FTSJD1-3384M 50 µg

Recombinant Mouse FTSJD1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Human PTGFR Alexa Fluor 594 MAb (Clone 1014602)
FAB10294T-100UG 100 µg

Human PTGFR Alexa Fluor 594 MAb (Clone 1014602)

Sign In for Pricing
View Details
SND1 siRNA (Rat)
CRR1975-01 15 nmol

SND1 siRNA (Rat)

Sign In for Pricing
View Details
SND1 siRNA (Rat)
CRR1975-02 30 nmol

SND1 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Mouse CPM protein (C-6His)
CD00509-01 10 µg

Recombinant Mouse CPM protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse CPM protein (C-6His)
CD00509-02 50 µg

Recombinant Mouse CPM protein (C-6His)

Sign In for Pricing
View Details