Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chodl Rabbit Polyclonal Antibody (Biotin)

Chodl Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MT75, PRED, PRED12, 3110074E07Rik

UniProt

Q9CXM0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_624360

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb (RB1) Mouse Monoclonal Antibody [Clone:1B1]
E45M17029 100 µg

Rb (RB1) Mouse Monoclonal Antibody [Clone:1B1]

Sign In for Pricing
View Details
Lentiviral human ILVBL shRNA (UAS) - Lentiviral human ILVBL shRNA (UAS, iRFP) (25)
GTR15100634 1 Vial

Lentiviral human ILVBL shRNA (UAS) - Lentiviral human ILVBL shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human CTPS2 shRNA (UAS) - Lentiviral human CTPS2 shRNA (UAS, iRFP) plasmid
GTR15095152 1 Vial

Lentiviral human CTPS2 shRNA (UAS) - Lentiviral human CTPS2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
TSR2 Protein Vector (Mouse) (pPB-N-His)
PV242491 500 ng

TSR2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CEACAM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV684631 1.0 µg DNA

CEACAM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal LRCH4 Antibody (OTI1F8) [CoraFluor 1]
NBP2-72520CL1 0.1 mL

Mouse Monoclonal LRCH4 Antibody (OTI1F8) [CoraFluor 1]

Sign In for Pricing
View Details