Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asrgl1 Rabbit Polyclonal Antibody (HRP)

Asrgl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, ALP, ALP1, AU040643, AW060375, 2410004D18Rik

UniProt

Q8C0M9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ABCD3 shRNA (UAS) - Lentiviral human ABCD3 shRNA (UAS) (25)
GTR15353384 1 Vial

Lentiviral human ABCD3 shRNA (UAS) - Lentiviral human ABCD3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Collagen I/COL1A1 Rabbit Polyclonal Antibody (Fluoro550)
orb3075023 100 µg

Collagen I/COL1A1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Human PHYKPL Protein Lysate
MBS8417175-01 0.02 mg

Human PHYKPL Protein Lysate

Sign In for Pricing
View Details
Human PHYKPL Protein Lysate
MBS8417175-02 5x 0.02 mg

Human PHYKPL Protein Lysate

Sign In for Pricing
View Details
2-Fluoro-4,5-dimethylphenylboronic Acid Pinacol Ester
417864-01 100 mg

2-Fluoro-4,5-dimethylphenylboronic Acid Pinacol Ester

Sign In for Pricing
View Details
2-Fluoro-4,5-dimethylphenylboronic Acid Pinacol Ester
417864-02 250 mg

2-Fluoro-4,5-dimethylphenylboronic Acid Pinacol Ester

Sign In for Pricing
View Details