Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1L Rabbit Polyclonal Antibody (Biotin)

SHCBP1L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GE36, C1orf14

UniProt

Q9BZQ2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ITGAQGAGVELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS703626-01 24 Well (LIMIT 1)

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS703626-02 48 Well

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS703626-03 96 Well

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS703626-04 5x 96 Well

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS703626-05 10x 96 Well

Chicken Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
APC-Cy7 anti-human CD19
FC0447 100 Tests

APC-Cy7 anti-human CD19

Sign In for Pricing
View Details