Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC2 Rabbit Polyclonal Antibody (Biotin)

NT5DC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ12442

UniProt

Q9H857

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (PE)
MBS6404148-01 0.1 mL

ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (PE)

Sign In for Pricing
View Details
ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (PE)
MBS6404148-02 5x 0.1 mL

ANGPTL3 (ANG-5, ANGPT5, Angiopoietin-5) (PE)

Sign In for Pricing
View Details
Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP)
MBS620223-01 0.1 mg

Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP)

Sign In for Pricing
View Details
Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP)
MBS620223-02 5x 0.1 mg

Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP)

Sign In for Pricing
View Details
Phospho-alpha Tubulin (Tyr272) Rabbit Monoclonal Antibody
AMRe03889-01 50 µL

Phospho-alpha Tubulin (Tyr272) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-alpha Tubulin (Tyr272) Rabbit Monoclonal Antibody
AMRe03889-02 100 µL

Phospho-alpha Tubulin (Tyr272) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details