Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMI1 Rabbit Polyclonal Antibody (HRP)

RMI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BLAP75, FAAP75, C9orf76

UniProt

Q9H9A7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RMI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079221

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC5 (NM_001012270) Human Over-expression Lysate
LY423314 100 µg

BIRC5 (NM_001012270) Human Over-expression Lysate

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405L conjugate, 0.1mg/mL
BNC061331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Txn1 Mouse Gene Knockout Kit (CRISPR)
KN318506RB 1 Kit

Txn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), Biotin conjugate, 0.1mg/mL
BNCB2024-100 1x 100 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Sudan, strain Gulu) VP40/Matrix protein VP40 Polyclonal Antibody
E-AB-V1115-01 20 µL

Anti-Ebola virus EBOV (subtype Sudan, strain Gulu) VP40/Matrix protein VP40 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Sudan, strain Gulu) VP40/Matrix protein VP40 Polyclonal Antibody
E-AB-V1115-02 100 µL

Anti-Ebola virus EBOV (subtype Sudan, strain Gulu) VP40/Matrix protein VP40 Polyclonal Antibody

Sign In for Pricing
View Details