Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRK Rabbit Polyclonal Antibody (HRP)

HRK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DP5, HARAKIRI

UniProt

O00198

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HRK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003797

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM219 Human qPCR Primer Pair (NM_194280)
HP232158 200 Reactions

TMEM219 Human qPCR Primer Pair (NM_194280)

Sign In for Pricing
View Details
GTF2A1L (ALF, GTF2A1LF, TFIIA-alpha and beta-like Factor, General Transcription Factor II A, 1-like Factor, MGC26254) (Biotin)
MBS6140569-01 0.1 mL

GTF2A1L (ALF, GTF2A1LF, TFIIA-alpha and beta-like Factor, General Transcription Factor II A, 1-like Factor, MGC26254) (Biotin)

Sign In for Pricing
View Details
GTF2A1L (ALF, GTF2A1LF, TFIIA-alpha and beta-like Factor, General Transcription Factor II A, 1-like Factor, MGC26254) (Biotin)
MBS6140569-02 5x 0.1 mL

GTF2A1L (ALF, GTF2A1LF, TFIIA-alpha and beta-like Factor, General Transcription Factor II A, 1-like Factor, MGC26254) (Biotin)

Sign In for Pricing
View Details
Anti-RIT2 Antibody Picoband®, PE Conjugate
A07833-1-PE 100 µg/Vial

Anti-RIT2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
RNF215 Polyclonal Antibody, PE-Cy5 Conjugated
bs-9264R-PE-Cy5 100 µL

RNF215 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
BCL-2 (Center Ser70) Rabbit pAb
MBS8555668-01 0.1 mL

BCL-2 (Center Ser70) Rabbit pAb

Sign In for Pricing
View Details