Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL18R1 Rabbit Polyclonal Antibody (HRP)

IL18R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD218a, IL18RA, IL1RRP, CDw218a, IL-1Rrp, IL-18Ralpha, IL18Ralpha2, IL-18R-alpha

UniProt

Q13478

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL18R1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Storage Plates 1.0ml 96 round well U bottom - Rimless - Black
1R96-006UNRBlack 50 Plates

Storage Plates 1.0ml 96 round well U bottom - Rimless - Black

Sign In for Pricing
View Details
Anti-CA15-3 McAb (coating)
MBS8584724-01 1 mg

Anti-CA15-3 McAb (coating)

Sign In for Pricing
View Details
Anti-CA15-3 McAb (coating)
MBS8584724-02 5x 1 mg

Anti-CA15-3 McAb (coating)

Sign In for Pricing
View Details
Monoclonal CD68 (Macrophage Marker) Antibody - Without BSA and Azide, Clone: SPM130
AMM00488G 0.1mg

Monoclonal CD68 (Macrophage Marker) Antibody - Without BSA and Azide, Clone: SPM130

Sign In for Pricing
View Details
MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (HRP)
248614-HRP 100 µL

MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (HRP)

Sign In for Pricing
View Details
PICPACK 372-148X148-B7541 Facility & Office Signs & Labels (Adhesive)
224110 25 Pack (1 Panel (s) x 25 Card)

PICPACK 372-148X148-B7541 Facility & Office Signs & Labels (Adhesive)

Sign In for Pricing
View Details