Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIP1 Rabbit Polyclonal Antibody (Biotin)

STIP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521

UniProt

P31948

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STIP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal antibody to RLIP (Clone: ABM1C8.1D9)
10-1068-25 25 µg

Monoclonal antibody to RLIP (Clone: ABM1C8.1D9)

Sign In for Pricing
View Details
Lentiviral human GPRC5D shRNA (UAS) - Lentiviral human GPRC5D shRNA (UAS, iRFP) (25)
GTR15352241 1 Vial

Lentiviral human GPRC5D shRNA (UAS) - Lentiviral human GPRC5D shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Mouse GPC6 Protein, N-His
orb3152835-01 50 µg

Recombinant Mouse GPC6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse GPC6 Protein, N-His
orb3152835-02 100 µg

Recombinant Mouse GPC6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse GPC6 Protein, N-His
orb3152835-03 1 mg

Recombinant Mouse GPC6 Protein, N-His

Sign In for Pricing
View Details
MARCH9 Protein Vector (Human) (pPM-C-HA)
PV093292 500 ng

MARCH9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details