Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL39 Rabbit Polyclonal Antibody (HRP)

MRPL39 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L5mt, L39mt, MRPL5, RPML5, MRP-L5, PRED22, PRED66, MSTP003, C21orf92

UniProt

Q9NYK5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCK4 Antibody
MBS7124595-01 0.05 mL

ADCK4 Antibody

Sign In for Pricing
View Details
ADCK4 Antibody
MBS7124595-02 0.1 mL

ADCK4 Antibody

Sign In for Pricing
View Details
ADCK4 Antibody
MBS7124595-03 5x 0.1 mL

ADCK4 Antibody

Sign In for Pricing
View Details
DHRS7B, ID (DHRS7B, Dehydrogenase/reductase SDR family member 7B) (Azide free) (HRP) discontinued
034626-HRP 200 µL

DHRS7B, ID (DHRS7B, Dehydrogenase/reductase SDR family member 7B) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial
orb3007738-01 20 µg

Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial
orb3007738-02 100 µg

Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial

Sign In for Pricing
View Details