Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDHD2, Human (His)

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HDHD2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hdhd2-protein-human-his.html

Smiles

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Molecular Formula

84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTC3-AS1 AAV Vector (Human) (CMV)
48682101 1 µg

TTC3-AS1 AAV Vector (Human) (CMV)

Ask
View Details
TMED9, CT (TMED9, GP25L2, Transmembrane emp24 domain-containing protein 9, GMP25, Glycoprotein 25L2, p24 family protein alpha-2, p25) (MaxLight 750)
MBS6356293-01 0.1 mL

TMED9, CT (TMED9, GP25L2, Transmembrane emp24 domain-containing protein 9, GMP25, Glycoprotein 25L2, p24 family protein alpha-2, p25) (MaxLight 750)

Ask
View Details
TMED9, CT (TMED9, GP25L2, Transmembrane emp24 domain-containing protein 9, GMP25, Glycoprotein 25L2, p24 family protein alpha-2, p25) (MaxLight 750)
MBS6356293-02 5x 0.1 mL

TMED9, CT (TMED9, GP25L2, Transmembrane emp24 domain-containing protein 9, GMP25, Glycoprotein 25L2, p24 family protein alpha-2, p25) (MaxLight 750)

Ask
View Details
Aquaporin 5 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61235R-BF405-01 20 µL

Aquaporin 5 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
Aquaporin 5 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61235R-BF405-02 100 µL

Aquaporin 5 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
hsa-miR-6514-3p miRNA Antagomir
MBS8317956-01 10 nmol

hsa-miR-6514-3p miRNA Antagomir

Ask
View Details