Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDHD2, Human (His)

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HDHD2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hdhd2-protein-human-his.html

Smiles

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Molecular Formula

84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLK3 Antibody
E51A04629 100 µL

PLK3 Antibody

Ask
View Details
SGK196 (POMK) (NM_032237) Human Over-expression Lysate
LY410261 100 µg

SGK196 (POMK) (NM_032237) Human Over-expression Lysate

Ask
View Details
Bcap31 (NM_001004224) Rat Tagged Lenti ORF Clone
RR200730L4 10 µg

Bcap31 (NM_001004224) Rat Tagged Lenti ORF Clone

Ask
View Details
ATR (C-1) : m-IgG Fc BP-HRP Bundle
sc-531302 1 Kit

ATR (C-1) : m-IgG Fc BP-HRP Bundle

Ask
View Details