Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDHD2, Human (His)

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HDHD2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hdhd2-protein-human-his.html

Smiles

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Molecular Formula

84064 (Gene_ID) Q9H0R4-1 (M1-L259) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

XC Chemokine Receptor 1 (G-Protein Coupled Receptor 5, Lymphotactin Receptor, SCM-1, Single Cysteine Motif 1 Receptor)
MBS6507352-01 0.1 mg

XC Chemokine Receptor 1 (G-Protein Coupled Receptor 5, Lymphotactin Receptor, SCM-1, Single Cysteine Motif 1 Receptor)

Ask
View Details
XC Chemokine Receptor 1 (G-Protein Coupled Receptor 5, Lymphotactin Receptor, SCM-1, Single Cysteine Motif 1 Receptor)
MBS6507352-02 5x 0.1 mg

XC Chemokine Receptor 1 (G-Protein Coupled Receptor 5, Lymphotactin Receptor, SCM-1, Single Cysteine Motif 1 Receptor)

Ask
View Details
Potassium Pyrosulfate
P6640 500 g

Potassium Pyrosulfate

Ask
View Details
TIMP2 Rabbit Polyclonal Antibody
TA325940 100 µL

TIMP2 Rabbit Polyclonal Antibody

Ask
View Details
Smc5 (NM_153808) Mouse Tagged ORF Clone
MR211612 10 µg

Smc5 (NM_153808) Mouse Tagged ORF Clone

Ask
View Details
Rabbit Polyclonal YAF2 Antibody [DyLight 405]
NBP2-04127V 0.1 mL

Rabbit Polyclonal YAF2 Antibody [DyLight 405]

Ask
View Details