Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt5 Rabbit Polyclonal Antibody (HRP)

B4galt5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AW049941, AW539721, 9430078I07Rik

UniProt

Q9JMK0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CISD2 Mouse Monoclonal Antibody [Clone ID: OTI4F8]
CF810357 100 µg

CISD2 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

Sign In for Pricing
View Details
ATP8B1 Human Gene Knockout Kit (CRISPR)
KN424841 1 Kit

ATP8B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), CF405S conjugate, 0.1mg/mL
BNC042783-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2783), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
trfp (MED20) (NM_004275) Human Over-expression Lysate
LC401368 20 µg

trfp (MED20) (NM_004275) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS639293 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]
HA720175F 100 µL

iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]

Sign In for Pricing
View Details