Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endogl1 Rabbit Polyclonal Antibody (Biotin)

Endogl1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ENG, ENDO, Engl, Engla, Englb, ENGL-B, ENGL-a, Endogl1, Endogl2, AW557704

UniProt

Q8C163

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPSVP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caps Hospital Disposable - PK120
M42022 120 / PCK

Caps Hospital Disposable - PK120

Sign In for Pricing
View Details
Pirin Immunizing Peptide
orb17498 100 µg

Pirin Immunizing Peptide

Sign In for Pricing
View Details
UQCRC2 (Cytochrome b-c1 Complex Subunit 2, Mitochondrial, Complex III Subunit 2, Core Protein II, Ubiquinol-cytochrome-c Reductase Complex Core Protein 2)
135125 50 µg

UQCRC2 (Cytochrome b-c1 Complex Subunit 2, Mitochondrial, Complex III Subunit 2, Core Protein II, Ubiquinol-cytochrome-c Reductase Complex Core Protein 2)

Sign In for Pricing
View Details
Nori® Feline MMP-13 ELISA Kit
GR188161 96 Well

Nori® Feline MMP-13 ELISA Kit

Sign In for Pricing
View Details
Anti-Homer1L Antibody FL650 Conjugate
75-453-FL650 200 µL

Anti-Homer1L Antibody FL650 Conjugate

Sign In for Pricing
View Details
DNMT3L, CT (DNMT3L, DNA (cytosine-5) -methyltransferase 3-like) (MaxLight 750) discontinued
034758-ML750 100 µL

DNMT3L, CT (DNMT3L, DNA (cytosine-5) -methyltransferase 3-like) (MaxLight 750) discontinued

Sign In for Pricing
View Details