Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC63 Rabbit Polyclonal Antibody (Biotin)

SEC63 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERdj2, PCLD2, SEC63L, DNAJC23, PRO2507

UniProt

Q9UGP8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SEC63

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Formamido-4-thiazolyl)glyoxylic Acid Hydrate
TRC-F692110-250MG 250 mg

2-(2-Formamido-4-thiazolyl)glyoxylic Acid Hydrate

Sign In for Pricing
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (rPECAM1/8830) [Alexa Fluor 750]
NBP3-23989AF750 0.1 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (rPECAM1/8830) [Alexa Fluor 750]

Sign In for Pricing
View Details
Homeobox protein MSX-1 (MSX1) Antibody (HRP)
abx336045-01 20 µg

Homeobox protein MSX-1 (MSX1) Antibody (HRP)

Sign In for Pricing
View Details
Homeobox protein MSX-1 (MSX1) Antibody (HRP)
abx336045-02 50 µg

Homeobox protein MSX-1 (MSX1) Antibody (HRP)

Sign In for Pricing
View Details
Homeobox protein MSX-1 (MSX1) Antibody (HRP)
abx336045-03 100 µg

Homeobox protein MSX-1 (MSX1) Antibody (HRP)

Sign In for Pricing
View Details
Homeobox protein MSX-1 (MSX1) Antibody (HRP)
abx336045-04 200 µg

Homeobox protein MSX-1 (MSX1) Antibody (HRP)

Sign In for Pricing
View Details