Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGR4 Rabbit Polyclonal Antibody (HRP)

SYNGR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC125805

UniProt

O95473

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SYNGR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1B2 AAV Vector (Human) (CMV)
12788101 1 µg

ATP6V1B2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Lentiviral human TMEM63B shRNA (UAS) - Lentiviral human TMEM63B shRNA (UAS, RFP) (100)
GTR15337311 1 Vial

Lentiviral human TMEM63B shRNA (UAS) - Lentiviral human TMEM63B shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OLR1 (Oxidized Low Density Lipoprotein (Lectin-like) Receptor 1, CLEC8A, LOX1, SCARE1)
249599 50 µL

OLR1 (Oxidized Low Density Lipoprotein (Lectin-like) Receptor 1, CLEC8A, LOX1, SCARE1)

Sign In for Pricing
View Details
SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC
MBS6394070-01 0.1 mL

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC

Sign In for Pricing
View Details
SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC
MBS6394070-02 5x 0.1 mL

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) APC

Sign In for Pricing
View Details
TANK (NM_004180) Human Recombinant Protein
TP309759L 1 mg

TANK (NM_004180) Human Recombinant Protein

Sign In for Pricing
View Details