Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN3 Rabbit Polyclonal Antibody (FITC)

CLSTN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSTN3, CDHR14, alcbeta

UniProt

Q9BQT9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLSTN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055533

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmvk siRNA Oligos set (Mouse)
37089174 3x 5 nmol

Pmvk siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Jmjd8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25252116 3x 1.0 µg

Jmjd8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RHOA (NM_001664) Human Over-expression Lysate
LH19707V 100 µg

RHOA (NM_001664) Human Over-expression Lysate

Sign In for Pricing
View Details
TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (MaxLight 550)
MBS6403030-01 0.1 mL

TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (MaxLight 550)

Sign In for Pricing
View Details
TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (MaxLight 550)
MBS6403030-02 5x 0.1 mL

TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (MaxLight 550)

Sign In for Pricing
View Details
Ethoxyquin
T0756-01 1 g

Ethoxyquin

Sign In for Pricing
View Details