Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC16 Rabbit Polyclonal Antibody (Biotin)

DNAJC16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERdj8

UniProt

Q9Y2G8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DJC16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Phospho-AP2M1 (Thr156) antibody
SL11242R-01 50 µL

Rabbit Anti-Phospho-AP2M1 (Thr156) antibody

Sign In for Pricing
View Details
Rabbit Anti-Phospho-AP2M1 (Thr156) antibody
SL11242R-02 100 µL

Rabbit Anti-Phospho-AP2M1 (Thr156) antibody

Sign In for Pricing
View Details
PDCD2L sgRNA CRISPR Lentivector set (Human)
K1616001 3x 1.0 µg

PDCD2L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) (Biotin)
MBS6140534-01 0.1 mL

AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) (Biotin)

Sign In for Pricing
View Details
AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) (Biotin)
MBS6140534-02 5x 0.1 mL

AKAP10 (A-kinase Anchor Protein 10, Mitochondrial, AKAP-10, Dual Specificity A Kinase-anchoring Protein 2, D-AKAP-2, Protein Kinase A-anchoring Protein 10, PRKA10) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Calpain 2 Antibody (OTI3G1) [HRP]
NBP2-70334H 0.1 mL

Mouse Monoclonal Calpain 2 Antibody (OTI3G1) [HRP]

Sign In for Pricing
View Details