Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdhd2 Rabbit Polyclonal Antibody (HRP)

Hdhd2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ier3ip1, LRRG00122, RGD1308579

UniProt

Q6QI86

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hdhd2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/XFD700 Anti-mouse CD19 Antibody *1D3*
101941O0-AAT 25 Tests

PE/XFD700 Anti-mouse CD19 Antibody *1D3*

Sign In for Pricing
View Details
MAGB4 Antibody
E19-9017-2 100 µg -100 µL

MAGB4 Antibody

Sign In for Pricing
View Details
Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)
MBS2100298-01 5x 96 Tests

Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)
MBS2100298-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)
MBS2100298-03 10x 96 Tests

Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)
MBS2100298-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Immunoglobulin Associated Alpha (Iga) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details