Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF2 Rabbit Polyclonal Antibody (FITC)

TMEFF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TR, HPP1, TPEF, TR-2, TENB2, CT120.2

UniProt

Q9UIK5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD1, NT (FOXD1, FKHL8, FREAC4, Forkhead box protein D1, Forkhead-related protein FKHL8, Forkhead-related transcription factor 4) (MaxLight 550)
MBS6299747-01 0.1 mL

FOXD1, NT (FOXD1, FKHL8, FREAC4, Forkhead box protein D1, Forkhead-related protein FKHL8, Forkhead-related transcription factor 4) (MaxLight 550)

Sign In for Pricing
View Details
FOXD1, NT (FOXD1, FKHL8, FREAC4, Forkhead box protein D1, Forkhead-related protein FKHL8, Forkhead-related transcription factor 4) (MaxLight 550)
MBS6299747-02 5x 0.1 mL

FOXD1, NT (FOXD1, FKHL8, FREAC4, Forkhead box protein D1, Forkhead-related protein FKHL8, Forkhead-related transcription factor 4) (MaxLight 550)

Sign In for Pricing
View Details
GLP2R Rabbit Polyclonal Antibody (BF647)
orb2390056 100 µL

GLP2R Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CBF beta antibody
70R-31877 0.1 mg

CBF beta antibody

Sign In for Pricing
View Details
ARPP19 (cAMP-Regulated Phosphoprotein 19)
475662 100 µL

ARPP19 (cAMP-Regulated Phosphoprotein 19)

Sign In for Pricing
View Details
Mouse Synapse-associated protein 1, SYAP1 ELISA Kit
MBS9335942-01 48 Well

Mouse Synapse-associated protein 1, SYAP1 ELISA Kit

Sign In for Pricing
View Details