Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lpcat2 Rabbit Polyclonal Antibody (FITC)

Lpcat2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ayt, LPC, Aytl1, Aytl1a, lpafat1, lysoPAFAT, 1-AGPAT 11, A330042H22, lysoPAFAT/LPCAT2

UniProt

Q8BYI6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQIL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF1 Protein Lysate (Mouse) with C-HA Tag
38552035 100 µg

RASSF1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-CD160 antibody (DMC270), IgG1 Chimeric mAb
12-9213-100 100 µg

Anti-CD160 antibody (DMC270), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Mouse Idh3b Pre-designed siRNA Set B
SI106493B 1 Each

Mouse Idh3b Pre-designed siRNA Set B

Sign In for Pricing
View Details
JNK Inhibitor VIII
C12952-25mg 25 mg

JNK Inhibitor VIII

Sign In for Pricing
View Details
Human IRF2 Recombinant Protein
PROTP14316-100ug 100 µg

Human IRF2 Recombinant Protein

Sign In for Pricing
View Details
Mouse Programmed Cell Death Protein 6 Interacting Protein (PDCD6IP) Antibody Pair Kit (with Standard)
MBS2100097-01 5x 96 Tests

Mouse Programmed Cell Death Protein 6 Interacting Protein (PDCD6IP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details