Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lpcat2 Rabbit Polyclonal Antibody (FITC)

Lpcat2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ayt, LPC, Aytl1, Aytl1a, lpafat1, lysoPAFAT, 1-AGPAT 11, A330042H22, lysoPAFAT/LPCAT2

UniProt

Q8BYI6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQIL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Kv4.2 (Thr602) Polyclonal Antibody, PE-Cy7 Conjugated
bs-9443R-PE-Cy7 100 µL

Phospho-Kv4.2 (Thr602) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Guinea pig natural killer cell (NK) ELISA Kit
MBS2608003-01 48 Well

Guinea pig natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig natural killer cell (NK) ELISA Kit
MBS2608003-02 96 Well

Guinea pig natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig natural killer cell (NK) ELISA Kit
MBS2608003-03 5x 96 Well

Guinea pig natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Guinea pig natural killer cell (NK) ELISA Kit
MBS2608003-04 10x 96 Well

Guinea pig natural killer cell (NK) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Katnb1 shRNA (UAS) - Lentiviral mouse Katnb1 shRNA (UAS, GFP) (100)
GTR15288849 1 Vial

Lentiviral mouse Katnb1 shRNA (UAS) - Lentiviral mouse Katnb1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details