Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF131 Rabbit Polyclonal Antibody (FITC)

ZNF131 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZBTB35, pHZ-10

UniProt

P52739

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF131

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Su (var) 3-3 Antibody
orb805719 2 mg

Su (var) 3-3 Antibody

Sign In for Pricing
View Details
PIG-A CRISPR/Cas9 KO Plasmid (m)
sc-422226 20 µg

PIG-A CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKCBP2, RACK17) (AP) discontinued
130712-AP 100 µL

OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKCBP2, RACK17) (AP) discontinued

Sign In for Pricing
View Details
DPYSL4 Antibody, Biotin conjugated
MBS7048048-01 0.05 mg

DPYSL4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DPYSL4 Antibody, Biotin conjugated
MBS7048048-02 0.1 mg

DPYSL4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DPYSL4 Antibody, Biotin conjugated
MBS7048048-03 5x 0.1 mg

DPYSL4 Antibody, Biotin conjugated

Sign In for Pricing
View Details