Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCKAP1L Rabbit Polyclonal Antibody (HRP)

NCKAP1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEM1, IMD72

UniProt

P55160

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NCKAP1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 peptide
orb382428-01 1 mg

IRF3 peptide

Sign In for Pricing
View Details
IRF3 peptide
orb382428-02 5 mg

IRF3 peptide

Sign In for Pricing
View Details
NT-proBNP (61-76)
471197 1 mg

NT-proBNP (61-76)

Sign In for Pricing
View Details
BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 750)
MBS6277909-01 0.1 mL

BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 750)

Sign In for Pricing
View Details
BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 750)
MBS6277909-02 5x 0.1 mL

BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum ER lumen protein retaining receptor (kdelr)
orb2912370-01 20 µg

Recombinant Dictyostelium discoideum ER lumen protein retaining receptor (kdelr)

Sign In for Pricing
View Details