Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Meis3 Rabbit Polyclonal Antibody (Biotin)

Meis3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mrg2

UniProt

D4A9U2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRBP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
32155156 3x 1.0 µg DNA

NRBP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Taste Receptor type 2 member 4 (TAS2R4) Mouse ELISA Kit
H4702 96 Tests

Taste Receptor type 2 member 4 (TAS2R4) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral human ZNF454 sgRNA gene knockout kit - Lentiviral human ZNF454 sgRNA gene knockout kit (25)
GTR15386418 1 Vial

Lentiviral human ZNF454 sgRNA gene knockout kit - Lentiviral human ZNF454 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Siglec 5, CT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (FITC)
MBS6499378-01 0.2 mL

Siglec 5, CT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (FITC)

Sign In for Pricing
View Details
Siglec 5, CT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (FITC)
MBS6499378-02 5x 0.2 mL

Siglec 5, CT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (FITC)

Sign In for Pricing
View Details
Sheep Glycine amidinotransferase, mitochondrial (GATM) ELISA Kit
GTR10316017 96 Well

Sheep Glycine amidinotransferase, mitochondrial (GATM) ELISA Kit

Sign In for Pricing
View Details