Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF5A Rabbit Polyclonal Antibody (HRP)

PHF5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INI, Rds3, SF3B7, SAP14b, SF3b14b, bK223H9.2

UniProt

Q7RTV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORBS1 (NM_001290297) Human Untagged Clone
SC337510 10 µg

SORBS1 (NM_001290297) Human Untagged Clone

Sign In for Pricing
View Details
Dulbecco's Modified Eagle's Medium With High Glucose, L-Glutamine and Sodium Pyruvate Without Phenol Red and Sodium Bicarbonate
DMP07-10LT 10 L

Dulbecco's Modified Eagle's Medium With High Glucose, L-Glutamine and Sodium Pyruvate Without Phenol Red and Sodium Bicarbonate

Sign In for Pricing
View Details
Tetratricopeptide Repeat Protein 39A (TTC39A) Antibody
abx239085 100 µg

Tetratricopeptide Repeat Protein 39A (TTC39A) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Igf2r shRNA (UAS) - Lentiviral mouse Igf2r shRNA (UAS, GFP) (100)
GTR15292125 1 Vial

Lentiviral mouse Igf2r shRNA (UAS) - Lentiviral mouse Igf2r shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TLR8 HEK-293 Cell Line
ABC-X0661F 1 Vial

TLR8 HEK-293 Cell Line

Sign In for Pricing
View Details
CDC7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15635061 1.0 µg DNA

CDC7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details