Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf31 Rabbit Polyclonal Antibody (FITC)

C3orf31 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAM41, TAM41, C3orf31

UniProt

Q96BW9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf31

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Surface Antigen (HBsAg) (FITC)
MBS6249917-01 0.1 mL

Hepatitis B Surface Antigen (HBsAg) (FITC)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) (FITC)
MBS6249917-02 5x 0.1 mL

Hepatitis B Surface Antigen (HBsAg) (FITC)

Sign In for Pricing
View Details
Hex CRISPR Activation Plasmid (m)
sc-420852-ACT 20 µg

Hex CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Porcine Casp8 ELISA Kit
EF016726 96 Tests

Porcine Casp8 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human MBD3 shRNA (UAS) - Lentiviral human MBD3 shRNA (UAS, RFP) (100)
GTR15299043 1 Vial

Lentiviral human MBD3 shRNA (UAS) - Lentiviral human MBD3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (MaxLight 405) discontinued
133942-ML405 100 µL

STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (MaxLight 405) discontinued

Sign In for Pricing
View Details