Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exd Rabbit Polyclonal Antibody (FITC)

Exd Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Anon-EST:fe1H3, CG8933, DExd, Dm-EXD, Dmel\CG8933, Dpbx, Exd, EXD, l (1) IV, lincRNA.S9404, Pbx1, td48

UniProt

P40427

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_727924

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP17 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38475064 1.0 µg DNA

RANBP17 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HMGB4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
23580061 1.0 µg DNA

HMGB4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human E3 Ubiquitin-Protein Ligase TRIM63 (TRIM63) ELISA Kit
abx383941 96 Tests

Human E3 Ubiquitin-Protein Ligase TRIM63 (TRIM63) ELISA Kit

Sign In for Pricing
View Details
S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein
MBS6224481-01 0.1 mL

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Sign In for Pricing
View Details
S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein
MBS6224481-02 5x 0.1 mL

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Sign In for Pricing
View Details
CD5 Antibody [B19.1] (APC)
98-600 0.1 mg

CD5 Antibody [B19.1] (APC)

Sign In for Pricing
View Details