Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fxn Rabbit Polyclonal Antibody (HRP)

Fxn Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FA, Fr, X25, FARR, Frda

UniProt

O35943

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TYW3 Antibody
A15678 0.1 mg

Anti-TYW3 Antibody

Sign In for Pricing
View Details
Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)
RPU50450-01 50 µg

Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)

Sign In for Pricing
View Details
Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)
RPU50450-02 100 µg

Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)

Sign In for Pricing
View Details
Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)
RPU50450-03 1 mg

Recombinant Human Endothelial Differentiation Related Factor 1 (EDF1)

Sign In for Pricing
View Details
c-Jun Polyclonal Antibody
MBS194196-01 0.025 mL

c-Jun Polyclonal Antibody

Sign In for Pricing
View Details
c-Jun Polyclonal Antibody
MBS194196-02 0.1 mg

c-Jun Polyclonal Antibody

Sign In for Pricing
View Details