Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAZ Rabbit Polyclonal Antibody (FITC)

YWHAZ Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HEL4, YWHAD, KCIP-1, HEL-S-3, POPCHAS, HEL-S-93, 14-3-3-zeta

UniProt

P63104

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human YWHAZ

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMF1 Rabbit Polyclonal Antibody
orb556201 100 µL

PSMF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCLRE1C Rabbit Polyclonal Antibody
orb626281-01 50 µg

DCLRE1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCLRE1C Rabbit Polyclonal Antibody
orb626281-02 100 µg

DCLRE1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Centrifuge Tubes 15 ml
TCF001-00 4x 15 mL

Centrifuge Tubes 15 ml

Sign In for Pricing
View Details
Pdk4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3454106 1.0 µg DNA

Pdk4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Apolipoprotein E3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5039R-BF488-TR 20 µL

Apolipoprotein E3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details