Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAZ Rabbit Polyclonal Antibody (FITC)

YWHAZ Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HEL4, YWHAD, KCIP-1, HEL-S-3, POPCHAS, HEL-S-93, 14-3-3-zeta

UniProt

P63104

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human YWHAZ

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exportin 4 (XPO4) (NM_022459) Human Recombinant Protein
TP312569 20 µg

Exportin 4 (XPO4) (NM_022459) Human Recombinant Protein

Sign In for Pricing
View Details
Lamin A/C Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62887R-BF488-01 20 µL

Lamin A/C Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Lamin A/C Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62887R-BF488-02 100 µL

Lamin A/C Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Bimosiamose disodium
orb1707552 25 mg

Bimosiamose disodium

Sign In for Pricing
View Details
Rel Antibody
MBS8512408-01 0.05 mg

Rel Antibody

Sign In for Pricing
View Details
Rel Antibody
MBS8512408-02 0.1 mg

Rel Antibody

Sign In for Pricing
View Details