Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E130311K13Rik Rabbit Polyclonal Antibody (HRP)

E130311K13Rik Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STGMAIAGIMLLIRSVRLTSKFTTSSDIPVEFIRKKVKLRGRLQRITECG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002725693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7/17 (C-46), CF405S conjugate, 0.1mg/mL
BNC040949-500 1x 500 µL

Cytokeratin 7/17 (C-46), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF647 conjugate, 0.1mg/mL
BNC473065-100 1x 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), 0.2mg/mL
BNUB0472-500 1x 500 µL

CD45RB (PD7/26), 0.2mg/mL

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF594 conjugate, 0.1mg/mL
BNC940708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat ENPEP/Aminopeptidase A Protein (aa 41-945, His Tag)
PKSR030189 50 µg

Recombinant Rat ENPEP/Aminopeptidase A Protein (aa 41-945, His Tag)

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199UC-01 25 µg

FITC Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details